PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 902822
Common NameARALYDRAFT_902822, TKI1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 741aa    MW: 81817.4 Da    PI: 6.0195
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
902822genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14e-085799347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
           902822 57 AWTHQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 99
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-1049104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-552102IPR009057Homeodomain-like
PROSITE profilePS5129313.5253104IPR017884SANT domain
SMARTSM007175.1E-654102IPR001005SANT/Myb domain
CDDcd001671.21E-557100No hitNo description
PfamPF002493.1E-65799IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MLKQFAHYCE MQAELKPEGP NGEGRLSNQN SNPNLLSSAS ITVAQFPAKK PTRQWAAWTH  60
QEEESFFTAL RQVGKNFEKI TSRVQSKNKD QVRHYYYRLV RRMNKLLGPE LSLDAKNPKD  120
TNAAMLRWWS LLEKYSCKAS KLHLKPRRFK LFIEALEHQL LKDRRKSIRK RACQGENLSS  180
ASLGNISSHS RERGLDNRPF KLILSDGQNV KKLGPGRAST KHGESLGVIL GEEKEDTAFG  240
RGGRQRRKQG YRKWEKAAID GVSLVADAAE HLERTSIDKD MDDQTELGPS RYLTGKSPLS  300
LCSSGDILLS DTNMQFSAKL KLQLFPIDEC TRRSLEMDKH NPHLELTLSN RKKISSVLEH  360
LNRKWGSASC ATGELLLFPY NARKETVTCH QRWTHDSFLS AAEVHSMVGS PSVFRLRYGW  420
FVHDASGSII SQVPTSDPCP SLEDDMNVDG VNEVNMLLTE SGPLSVHSTA EQATSVEPSQ  480
GLVCASGEIH DHPAESRDDY EAASTTITPL EHLSSGNAQS AGEWADSLTN ISIGDLLSEV  540
PDDIDSDGVD PPATEGSHYL LRDVPFASDS FDAAIAAHIL RHQNKPSALL PLTSGSSSLW  600
DDEETRDAFS FQKNRLADST ELASVASHRV NGEPSQLVEV LSGDEGSCNP PDHGDPMEEG  660
PTDPQTMDSP GKTPCGLADV YWPDSLGPLD LDIRSSKYTE DLILSESLGG LSRLIATSLD  720
AFQNCSLFGF DNKKDKSNMV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0640680.0AY064068.1 Arabidopsis thaliana unknown protein (At2g36960) mRNA, complete cds.
GenBankAY0963760.0AY096376.1 Arabidopsis thaliana unknown protein (At2g36960) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002879635.10.0tsl-kinase interacting protein 1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLD7LJ990.0D7LJ99_ARALL; Tsl-kinase interacting protein 1
STRINGscaffold_402323.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96332124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.10.0TSL-kinase interacting protein 1